General Information

  • ID:  hor002402
  • Uniprot ID:  P27114
  • Protein name:  Motilin-associated peptide
  • Gene name:  MLN
  • Organism:  Oryctolagus cuniculus (Rabbit)
  • Family:  Motilin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oryctolagus (genus), Leporidae (family), Lagomorpha (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SLSVQQRSDAAAAPRPAEPTLEEENGRMQLTAPVEIGMRMNSRQLEKYRAALEAAERAVHPDAPSRPCWPAGGESGWSGEPSPT
  • Length:  84
  • Propeptide:  MVSRKAVAALLLVHVTAMLASQTEAFVPIFTYSELQRMQERERNRGHKKSLSVQQRSDAAAAPRPAEPTLEEENGRMQLTAPVEIGMRMNSRQLEKYRAALEAAERAVHPDAPSRPCWPAGGESGWSGEPSPT
  • Signal peptide:  MVSRKAVAALLLVHVTAMLASQTEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  MLNR
  • Target Unid:  A5A4K8
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01019-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P01019-F1.pdbhor002402_AF2.pdbhor002402_ESM.pdb

Physical Information

Mass: 1052162 Formula: C383H609N119O127S4
Absent amino acids: F Common amino acids: A
pI: 4.78 Basic residues: 10
Polar residues: 21 Hydrophobic residues: 24
Hydrophobicity: -81.43 Boman Index: -20180
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 53.69
Instability Index: 6459.76 Extinction Coefficient cystines: 12490
Absorbance 280nm: 150.48

Literature

  • PubMed ID:  NA
  • Title:  NA